The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the BRCT domain from human DNA repair protein REV1. To be Published
    Site RSGI
    PDB Id 2ebw Target Id hso003006822.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13095, Molecular Weight 10250.32 Da.
    Residues 90 Isoelectric Point 9.40
    Sequence tsstifsgvaiyvngytdpsaeelrklmmlhggqyhvyysrsktthiiatnlpnakikelkgekvirpe wivesikagrllsyipyqlyt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ebw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch