The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structural Basis for the Exo-mode of Action in GH74 Oligoxyloglucan Reducing End-specific Cellobiohydrolase. J.Mol.Biol. 370 53-62 2007
    Site RSGI
    PDB Id 2ebs Target Id my_001000024.1
    Molecular Characteristics
    Source Geotrichum sp. m128
    Alias Ids TPS13694, Molecular Weight 84893.55 Da.
    Residues 789 Isoelectric Point 5.29
    Sequence kehyefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmnimgtesi aldpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnngerlavnpfnsnevwm gtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngtiyasatapqgmyvthdggvswepv agqpsswlnrttgafpdkkpasiapqpmkvaltpnflyvtyadypgpwgvtfgevwrqnrtsgawddit prvgnsspapynnqtfpaggfcglsvdatnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlssp snlegnwghptnaarykdgtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygt gatiwatdtlsrvekdwapswylqidgieenailslrspksgaallsgigdisgmkhddltkpqkmfga pqfsnldsidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstiavd asgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdggkffvstdggk syaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrvgtanatlvsvgapksksdgk kasapsavfiwgtdkpgsdiglyrsddngstwtrvndqehnysgptmieadpkvygrvylgtngrgivy adltnkksneekstakcangqkgthcyvkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.21925
    Matthews' coefficent 2.81 Rfactor 0.1585
    Waters 1078 Solvent Content 56.17

    Ligand Information


    Google Scholar output for 2ebs

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch