The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Zinc finger, C4-type domain of human COUP transcription factor 1. To be Published
    Site RSGI
    PDB Id 2ebl Target Id hso004011358.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13172, Molecular Weight 8887.88 Da.
    Residues 76 Isoelectric Point 9.71
    Sequence iecvvcgdkssgkhygqftcegcksffkrsvrrnltytcranrncpidqhhrnqcqycrlkkclkvgmr reavqrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ebl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch