.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ebj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pyrrolidone carboxyl peptidase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ebj Target Id ttk003000955.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14497, Molecular Weight 21118.37 Da.
    Residues 192 Isoelectric Point 5.76
    Sequence milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpkavlhlglaed rpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlarwreagipgrpslsagsyl cnqafylslyrlpeevpvgflhlppdetlalkrprpyvplevqaravrlalehl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.257
    Matthews' coefficent 2.61 Rfactor 0.228
    Waters 239 Solvent Content 52.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ebj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch