The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Lys11 to Met mutant of hypothetical protein from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ebe Target Id ttk003001907.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14822, Molecular Weight 11851.07 Da.
    Residues 106 Isoelectric Point 4.42
    Sequence mqavrlfqgymwhpralaldlkallpgevagarllwdevppptpffedgtpthtqrfyqltllvlteep pealkplaeeaaealgevleglppevgwllledlrpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.25
    Matthews' coefficent 2.41 Rfactor 0.225
    Waters 210 Solvent Content 49.05

    Ligand Information


    Google Scholar output for 2ebe

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch