The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase III from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2ebd Target Id aae001001099.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12058, Molecular Weight 33823.34 Da.
    Residues 309 Isoelectric Point 6.39
    Sequence mgtkiigtgvylpknvltnfdlekivdtsdewittrtgikerriakeetitymatqaakealreanlsp eeldliilatltpqkrfpstaclvqaqlkakgvyafdisaacsgfiyaldiadsfiksgkaknvlviga eklseavdwedrstcvlfgdgagavvvtrsedksdilatrmyaegsleellhadncgyirmkgrelfkv avrsmeevcrevlekagvkpeevslviphqanvriinalaeklnipkekvfvniqkygntsaasipial heaikegkvkrgdlilmtamgggltwgavllry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.226
    Matthews' coefficent 2.42 Rfactor 0.196
    Waters 383 Solvent Content 49.25

    Ligand Information


    Google Scholar output for 2ebd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch