The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from Geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2ebb Target Id gka001001984.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12306, Molecular Weight 12160.25 Da.
    Residues 103 Isoelectric Point 6.35
    Sequence ghmrlteeevqallekadgwkladerwivkkyrfqdylqgiefvrriaaisenanhhpfisidyklitv klsswrakgltkldfdlakqydevynqmkqgege
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.237
    Matthews' coefficent 2.06 Rfactor 0.223
    Waters 107 Solvent Content 40.37

    Ligand Information


    Google Scholar output for 2ebb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch