The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mutated EGFR kinase domain (L858R) in complex with AMPPNP. To be Published
    Site RSGI
    PDB Id 2eb3 Target Id ar_001000562.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12191, Molecular Weight 37342.28 Da.
    Residues 328 Isoelectric Point 5.59
    Sequence sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeildea yvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyledrr lvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdvwsyg vtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfreliiefsk mardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.84 Rfree 0.236
    Matthews' coefficent 3.32 Rfactor 0.190
    Waters 1 Solvent Content 62.92

    Ligand Information


    Google Scholar output for 2eb3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch