.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eb2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mutated EGFR kinase domain (G719S). To be Published
    Site RSGI
    PDB Id 2eb2 Target Id ar_001000562.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12190, Molecular Weight 37342.28 Da.
    Residues 328 Isoelectric Point 5.59
    Sequence sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeildea yvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyledrr lvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdvwsyg vtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfreliiefsk mardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.253
    Matthews' coefficent 3.37 Rfactor 0.198
    Waters 16 Solvent Content 63.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eb2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch