The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PDZ domain of KIAA0858 (LIM), MS0793 from Homo sapiens. To be Published
    Site RSGI
    PDB Id 2eaq Target Id hsk002100837.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12734, Molecular Weight 10146.83 Da.
    Residues 90 Isoelectric Point 4.67
    Sequence qfsdmrisinqtpgksldfgftikwdipgifvasveagspaefsqlqvddeiiainntkfsyndskewe eamakaqetghlvmdvrrygk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.46 Rfree 0.194
    Matthews' coefficent 1.85 Rfactor 0.16
    Waters 137 Solvent Content 33.65

    Ligand Information
    Metals NI (NICKEL) x 2


    Google Scholar output for 2eaq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch