The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein JW2626 from E.coli. To be Published
    Site RSGI
    PDB Id 2ea9 Target Id eco002002626.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12282, Molecular Weight 12256.09 Da.
    Residues 112 Isoelectric Point 6.04
    Sequence gssgssgmsnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqiesm lttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 2.35 Rfactor 0.223
    Waters 64 Solvent Content 47.74

    Ligand Information


    Google Scholar output for 2ea9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch