.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ea5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RING domain of the human Cell growth regulator with RING finger domain 1 protein. To be Published
    Site RSGI
    PDB Id 2ea5 Target Id hsi002014256.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12509, Molecular Weight 6286.95 Da.
    Residues 55 Isoelectric Point 5.01
    Sequence vepseenskdcvvcqngtvnwvllpcrhtclcdgcvkyfqqcpmcrqfvqesfal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2ea5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch