.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e9y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project APE1968 from Aeropyrum pernix K1. To be Published
    Site RSGI
    PDB Id 2e9y Target Id ape001001968.1
    Molecular Characteristics
    Source Aeropyrum pernix
    Alias Ids TPS12112, Molecular Weight 33667.77 Da.
    Residues 316 Isoelectric Point 6.05
    Sequence mdsgrlavialggnaiagpgmdvsvesqtaavkrassiiadvladgwrsvithgngpqvgylseafeal pperprqplyiatamtqawiglllkhsleeelrrrglnvlvpvvisrvlvdvsdpsfnnpskpvgpiyg reeaeelsrrygwvfkrdprggfrrvvpsprpvsivdrdliaeasaespavvalggggvpvverpggvl epveavvdkdlassllatqlnadllviltdvpgvavnygregerwlrraaaselkkylreghfppgsmg pkveaaisfvertgkpavigsleearqvlslqagtvvmlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.225
    Matthews' coefficent 2.32 Rfactor 0.2
    Waters 622 Solvent Content 47.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e9y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch