.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID PH0725 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2e8r Target Id pho001000725.27
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13876, Molecular Weight 29577.80 Da.
    Residues 265 Isoelectric Point 5.61
    Sequence mvlyfiglglyderditvkgleiamkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.218
    Matthews' coefficent 3.19 Rfactor 0.193
    Waters 536 Solvent Content 61.47

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2e8r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch