.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e8p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal SAM-domain of E74-like factor 3. To be Published
    Site RSGI
    PDB Id 2e8p Target Id hss001002151.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13288, Molecular Weight 9602.22 Da.
    Residues 85 Isoelectric Point 4.46
    Sequence qmslegtekaswlgeqpqfwsktqvldwisyqveknkydasaidfsrcdmdgatlcncaleelrlvfgp lgdqlhaqlrdltsss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e8p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch