.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e8m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the C-terminal SAM-domain of epidermal growth receptor pathway substrate 8. To be Published
    Site RSGI
    PDB Id 2e8m Target Id hso002000428.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12908, Molecular Weight 9455.33 Da.
    Residues 86 Isoelectric Point 9.58
    Sequence tigrsaaqkkfhvprqnvpvinitydstpedvktwlqskgfnpvtvnslgvlngaqlfslnkdelrtvc pegarvysqitvqkaal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e8m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch