.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2e7u Target Id ttk003000223.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14298, Molecular Weight 46031.51 Da.
    Residues 424 Isoelectric Point 6.35
    Sequence merpiseayfqeakrhipggvsspvrafkavggtppflvrgegayvwdadgnryldyvmswgplilgha hpkvlarvretlergltfgapsplevalakkvkraypfvdlvrfvnsgteatmsalrlargytgrpyiv kfrgnyhghadgllveagsgaltlgvpssagvpeeyakltlvleyndpeglrevlkrrgeeiaaiifep vvgnagvlvptedflkalheakaygvlliadevmtgfrlafggatellglkpdlvtlgkilggglpaaa yagrreimekvaplgpvyqagtlsgnplamaaglatlelleenpgyyayledlgarleaglkevlkekg lphtvnrvgsmitvfftegpvvtfqdarrtdtelfkrffhglldrgiywppsnfeaaflsvahreedve ktlealrkal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.198
    Matthews' coefficent 4.01 Rfactor 0.18
    Waters 427 Solvent Content 69.31

    Ligand Information
    Ligands PMP (4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE) x 1;GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2e7u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch