The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Insights into the Second Step of RNA-dependent Cysteine Biosynthesis in Archaea: Crystal Structure of Sep-tRNA:Cys-tRNA Synthase from Archaeoglobus fulgidus. J.Mol.Biol. 370 128-141 2007
    Site RSGI
    PDB Id 2e7i Target Id ar_001000847.2
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS12226, Molecular Weight 41928.03 Da.
    Residues 371 Isoelectric Point 7.14
    Sequence mfkretkdfinidplqtggklteearqallewgdgysvcdfcttgrldeiktppihdfihnqlpkflgc dvarvtngareakfavmhslakkdawvvmdenchyssyvaaeraglnialvpktdypdyaitpenfaqt ieetkkrgevvlalitypdgnygnlpdvkkiakvcseydvpllvngayaigrmpvslkeigadfivgsg hksmaasgpigvmgmkeewaeivlrrsekyknkevellgctargatiitlmasfphvrerikrwdeeve karrfaaemeklgikqlgdnphnhdlmffhaevlyeiskkakggrfflyrelksrkihgikpgltryfk lstyglsdeevdyvlnafkeiiekys
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.318
    Matthews' coefficent 3.89 Rfactor 0.271
    Waters 72 Solvent Content 68.35

    Ligand Information
    Ligands SO4 (SULFATE) x 5;PLP (PYRIDOXAL-5'-PHOSPHATE) x 1


    Google Scholar output for 2e7i

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch