The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second fn3 domain from human Ephrin type-B receptor 4. To be Published
    Site RSGI
    PDB Id 2e7h Target Id hso002002342.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13008, Molecular Weight 10450.07 Da.
    Residues 96 Isoelectric Point 9.53
    Sequence ppavsdirvtrsspsslslawavprapsgavldyevkyhekgaegpssvrflktsenraelrglkrgas ylvqvrarseagygpfgqehhsqtqld
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2e7h

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch