.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second KOW motif of human transcription elongation factor SPT5. To be Published
    Site RSGI
    PDB Id 2e6z Target Id hsk003001095.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12835, Molecular Weight 5944.54 Da.
    Residues 52 Isoelectric Point 4.68
    Sequence fqpgdnvevcegelinlqgkilsvdgnkitimpkhedlkdmlefpaqelrky
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e6z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch