The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the HMG box domain from human HMG-box transcription factor 1. To be published
    Site RSGI
    PDB Id 2e6o Target Id hsi002014558.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12515, Molecular Weight 9461.59 Da.
    Residues 80 Isoelectric Point 9.85
    Sequence gtvsatspnkckrpmnafmlfakkyrveytqmypgkdnraisvilgdrwkkmkneerrmytleakalae eqkrlnpdcwk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2e6o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch