The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the hyper-thermostability of CutA1. To be Published
    Site RSGI
    PDB Id 2e66 Target Id pho001000992.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13961, Molecular Weight 12303.56 Da.
    Residues 102 Isoelectric Point 5.01
    Sequence miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktrealweelkeri kelhpydvpaiiridvddvnedylkwlieetkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.253
    Matthews' coefficent 2.36 Rfactor 0.229
    Waters 326 Solvent Content 47.89

    Ligand Information
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1


    Google Scholar output for 2e66

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch