.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e63

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional characterization of the NHR1 domain of the Drosophila neuralized E3 ligase in the notch signaling pathway. J.Mol.Biol. 393 478-495 2009
    Site RSGI
    PDB Id 2e63 Target Id hsk002101756.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12782, Molecular Weight 17641.04 Da.
    Residues 163 Isoelectric Point 7.96
    Sequence elhprtgrlvslsacgrtarrqqpgqefnhglvlsreplrdgrvftvridrkvnswsgsieigvtaldp svldfpssatglkggswvvsgcsvlrdgrsvleeygqdldqlgegdrvgvertvagelrlwvngrdcgv aatglpprvwavvdlygkctqitvl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e63

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch