.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Insight into the Zinc Finger CW Domain as a Histone Modification Reader. Structure 18 1127-1139 2010
    Site RSGI
    PDB Id 2e61 Target Id hso003005504.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13053, Molecular Weight 7124.56 Da.
    Residues 62 Isoelectric Point 4.28
    Sequence eisgfgqclvwvqcsfpncgkwrrlcgnidpsvlpdnwscdqntdvqynrcdipeetwtgle
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2e61

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch