.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e5w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2e5w Target Id pho001000211.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13796, Molecular Weight 31968.27 Da.
    Residues 280 Isoelectric Point 5.17
    Sequence mrdmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyheplvhp amlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigidggilekmlsdkhekg kliigdgvkfieensgfdviivdstdpvgpaemlfseefyknayralndpgiyvtqagsvylftdeflt ayrkmrkvfdkvyyysfpvigyaspwaflvgvkgsidfmkvdaekgkklgleyydpdkhetlfqmpryi vqml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.215
    Matthews' coefficent 3.24 Rfactor 0.194
    Waters 827 Solvent Content 61.98

    Ligand Information
    Ligands ACT (ACETATE) x 4;AG3 (1-{4-[(3-AMINOPROPYL)AMINO]BUTYL}GUANIDINE) x 2;MTA (5'-DEOXY-5'-METHYLTHIOADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2e5w

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch