The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TUDOR domain of PHD finger protein 1 (PHF1 protein). To be Published
    Site RSGI
    PDB Id 2e5p Target Id hsi002006522.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12413, Molecular Weight 6305.90 Da.
    Residues 55 Isoelectric Point 4.52
    Sequence prlwegqdvlarwtdgllylgtikkvdsarevclvqfeddsqflvlwkdispaal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2e5p

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch