.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e5o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TRIP_4C domain of target of activating signal cointegrator 1. To be Published
    Site RSGI
    PDB Id 2e5o Target Id hso003004233.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13050, Molecular Weight 16809.73 Da.
    Residues 147 Isoelectric Point 9.46
    Sequence wclsvhqpwasllvrgikrvegrswytphrgrlwiaatakkpspqevselqatyrllrgkdvefpndyp sgcllgcvdlidclsqkqfkeqfpdisqesdspfvficknpqemvvkfpikgnpkiwkldskihqgakk glmkqnkav
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e5o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch