The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RNA binding domain in Methenyltetrahydrofolate synthetase domain containing. To be Published
    Site RSGI
    PDB Id 2e5j Target Id hss001000739.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13216, Molecular Weight 9770.59 Da.
    Residues 90 Isoelectric Point 10.75
    Sequence pgsppgegaplaadvyvgnlprdarvsdlkralrelgsvplrltwqgprrraflhypdsaaaqqavscl qglrlgtdtlrvalarqqrdk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2e5j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch