The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acetylornithine aminotransferase from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 2e54 Target Id tma001001785.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS14083, Molecular Weight 42882.08 Da.
    Residues 385 Isoelectric Point 6.00
    Sequence mylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlveaikdqaeklihcsnlfwn rpqmelaellskntfggkvffantgteaneaaikiarkygkkksekkyrilsahnsfhgrtlgsltatg qpkyqkpfeplvpgfeyfefnnvedlrrkmsedvcavflepiqgesgivpatkefleearklcdeydal lvfdevqcgmgrtgklfayqkygvvpdvlttakglgggvpigavivneranvlepgdhgttfggnplac ragvtvikeltkegfleeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfe nkllvvpagnntirflppltveygeidlavetlkkvlqgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.213
    Matthews' coefficent 2.37 Rfactor 0.196
    Waters 516 Solvent Content 48.19

    Ligand Information
    Metals NA (SODIUM) x 2


    Google Scholar output for 2e54

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch