The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis for Flexible Base Recognition by C/Ebpbeta. To be Published
    Site RSGI
    PDB Id 2e42 Target Id my_001000163.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13753, Molecular Weight 9329.29 Da.
    Residues 78 Isoelectric Point 10.23
    Sequence vkskakktvdkhsdeykirrernniaarksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl rnlfkqlpe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.252
    Matthews' coefficent 3.75 Rfactor 0.232
    Waters 316 Solvent Content 67.00

    Ligand Information


    Google Scholar output for 2e42

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch