.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e3v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4. To be Published
    Site RSGI
    PDB Id 2e3v Target Id hso002002037.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13002, Molecular Weight 11790.59 Da.
    Residues 109 Isoelectric Point 4.86
    Sequence psspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasmegivtivglkp ettyavrlaalngkglgeisaasefktqpvrepsapkleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.211
    Matthews' coefficent 2.73 Rfactor 0.182
    Waters 233 Solvent Content 54.92

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 3;PGE (TRIETHYLENE) x 2;BTB (2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2e3v

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch