.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e3c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic Studies on Multiple Conformational States of Active-site Loops in Pyrrolysyl-tRNA Synthetase. J.Mol.Biol. 378 634-652 2008
    Site RSGI
    PDB Id 2e3c Target Id trt001000322.4
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS14133, Molecular Weight 31069.94 Da.
    Residues 270 Isoelectric Point 5.46
    Sequence asapaltksqtdrlevllnpkdeislnsgkpfrelesellsrrkkdlqqiyaeerenylgklereitrf fvdrgfleikspilipleyiermgidndtelskqifrvdknfclrpmlapnlynylrkldralpdpiki feigpcyrkesdgkehleeftmlnfcqmgsgctrenlesiitdflnhlgidfkivgdscmvygdtldvm hgdlelssavvgpipldrewgidkpwigagfglerllkvkhdfknikraarsesyyngistnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.254
    Matthews' coefficent 3.34 Rfactor 0.200
    Waters 41 Solvent Content 63.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2e3c

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch