The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the homeobox domain from human NIL-2-A zinc finger protein, transcription factor 8. To be Published
    Site RSGI
    PDB Id 2e19 Target Id hsk003001367.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12841, Molecular Weight 6300.96 Da.
    Residues 57 Isoelectric Point 8.27
    Sequence qpplknllsllkayyalnaqpsaeelskiadsvnlpldvvkkwfekmqagqisvqss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2e19

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch