.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project PH0182 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2e18 Target Id pho001000182.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13792, Molecular Weight 28860.03 Da.
    Residues 257 Isoelectric Point 5.91
    Sequence mrildydkvierilefirekgnngvvigisggvdsatvaylatkalgkekvlglimpyfenkdvedakl vaeklgigykvinikpivdsfvenlelnldrkglgnimsrtrmimlyahanslgrivlgtsnrsefltg yftkwgdgasdyapiinlyktevweiakrigvperivkkkpsaglwegqtdedelgisynlldeilwrm idlkigkeeiakdlgiplslverveelikksehkrrlpigpsfedlivgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.262
    Matthews' coefficent 3.54 Rfactor 0.228
    Waters 437 Solvent Content 65.27

    Ligand Information
    Ligands IMD (IMIDAZOLE) x 3
    Metals ZN (ZINC) x 6

    Jmol

     
    Google Scholar output for 2e18

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch