.
The Open Protein Structure Annotation Network
PDB Keyword
.

2e16

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of diphthine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2e16 Target Id pho001000725.21
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13870, Molecular Weight 29601.85 Da.
    Residues 265 Isoelectric Point 6.11
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay prgnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.228
    Matthews' coefficent 3.18 Rfactor 0.203
    Waters 374 Solvent Content 61.38

    Ligand Information
    Ligands SO4 (SULFATE) x 6;SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2e16

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch