The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of mutant tryptophan synthase alpha-subunits from a hyperthermophile, Pyrococcus furiosus. To be Published
    Site RSGI
    PDB Id 2e09 Target Id my_001000046.9
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13731, Molecular Weight 27437.30 Da.
    Residues 248 Isoelectric Point 8.98
    Sequence mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralkngfklreaf wivkafrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvfhakefteiareegiktvf laapntpderlkviddmttgfvylvslygttgareeipktaydllrrakricrnkvavgfgvskrehvv sllkegangvvvgsalvkiigekgreateflkkkveellgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.283
    Matthews' coefficent 2.09 Rfactor 0.203
    Waters 447 Solvent Content 41.21

    Ligand Information


    Google Scholar output for 2e09

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch