.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dzp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of mutant tryptophan synthase alpha-subunits from a hyperthermophile, Pyrococcus furiosus. To be Published
    Site RSGI
    PDB Id 2dzp Target Id my_001000046.2
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS13724, Molecular Weight 27494.36 Da.
    Residues 248 Isoelectric Point 8.98
    Sequence mfkdgslipyltagdpnkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralkngfklreaf wivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvfhakefteiareegiktvf laapntpderlkviddmttgfvylvslygttgareeipktaydllrrakricrnkvavgfgvskrehvv sllkegangvvvgsalvkiigekgreateflkkkveellgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.279
    Matthews' coefficent 2.12 Rfactor 0.218
    Waters 360 Solvent Content 41.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dzp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch