The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3. To be Published
    Site RSGI
    PDB Id 2dzo Target Id ar_001000295.3
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS12141, Molecular Weight 25614.98 Da.
    Residues 228 Isoelectric Point 5.98
    Sequence msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenvnlddypd dsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfevsqfliengasvrikdk fnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhalaeghgdaavllvekygaeydlvdnk gakaedvalneqvkkfflnnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.282
    Matthews' coefficent 3.00 Rfactor 0.212
    Waters 206 Solvent Content 59.02

    Ligand Information


    Google Scholar output for 2dzo

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch