The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3. To be Published
    Site RSGI
    PDB Id 2dze Target Id ar_001000283.2
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS12138, Molecular Weight 18333.05 Da.
    Residues 161 Isoelectric Point 4.41
    Sequence msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtllvgpipigi nkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeglnlqemddaeikkvkvdi skvwrsilaekprvtrfniqwdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24352
    Matthews' coefficent 3.02 Rfactor 0.21364
    Waters 219 Solvent Content 59.33

    Ligand Information


    Google Scholar output for 2dze

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch