The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative translation initiation inhibitor PH0854 from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2dyy Target Id pho001000854.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13948, Molecular Weight 15380.07 Da.
    Residues 137 Isoelectric Point 5.11
    Sequence msfpyyfvvipmkeviftenapkpigpysqaikagnflfiagqipidpktgeivkgdikdqtrqvleni kaileaagyslndvikvtvylkdmndfakmnevyaeyfgeskparvavevsrlpkdvlieieaiayke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.60 Rfree 0.295
    Matthews' coefficent 2.01 Rfactor 0.209
    Waters 233 Solvent Content 38.80

    Ligand Information


    Google Scholar output for 2dyy

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch