.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dyj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural aspects of RbfA action during small ribosomal subunit assembly. Mol.Cell 28 434-445 2007
    Site RSGI
    PDB Id 2dyj Target Id ttk003000788.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14438, Molecular Weight 10856.06 Da.
    Residues 95 Isoelectric Point 10.42
    Sequence maygkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsraerrl vaalarrvrmrrlprleflpwraspa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.245
    Matthews' coefficent 1.85 Rfactor 0.199
    Waters 105 Solvent Content 33.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dyj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch