The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 16S ribosomal RNA processing protein RimM from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 2dyi Target Id ttk003000786.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14434, Molecular Weight 18071.86 Da.
    Residues 162 Isoelectric Point 5.05
    Sequence mrlveigrfgapyalkgglrfrgepvvlhlervyveghgwraiedlyrvgeelvvhlagvtdrtlaeal vglrvyaevadlppleegryyyfaliglpvyvegrqvgevvdildagaqdvliirgvgerlrdraerlv plqapyvrveegsihvdpipglfd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.256
    Matthews' coefficent 2.65 Rfactor 0.192
    Waters 137 Solvent Content 53.61

    Ligand Information


    Google Scholar output for 2dyi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch