.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dy0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of JW0458 from Escherichia coli. To be Published
    Site RSGI
    PDB Id 2dy0 Target Id eco002000458.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12272, Molecular Weight 19857.78 Da.
    Residues 183 Isoelectric Point 5.26
    Sequence mtataqqleylknsiksiqdypkpgilfrdvtslledpkayalsidllveryknagitkvvgteargfl fgapvalglgvgfvpvrkpgklpretisetydleygtdqleihvdaikpgdkvlvvddllatggtieat vklirrlggevadaafiinlfdlggeqrlekqgitsyslvpfpgh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.207
    Matthews' coefficent 2.13 Rfactor 0.198
    Waters 548 Solvent Content 42.35

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2dy0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch