.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dxz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2dxz Target Id pho001000965.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13954, Molecular Weight 113943.50 Da.
    Residues 967 Isoelectric Point 5.86
    Sequence maelnfkaieekwqkrwleakifepnirdkpkekkfyitvafpylsghlhvghartytipdviarfkrm qgynvlfpmawhitgspivgiaeriknrdpktiwiyrdvykvpeeilwtfedpinivkyfmkaaketfi ragfsvdwsrefyttslfppfskfiewqfwklkekgyivkgahrvrwdpvvgtplgdhdlmegedvpil dyiiikfelrengeviylpaatlrpetvygvtnmwvnpnatyvkakvrrkdkeetwivskeaayklsfq dreievieefkgekligkyvrnpvsgdeviilpaefvdpdnatgvvmsvpahapfdhvaledlkretei lekydidprivenityisliklegygdfpaveevnklgiksqkdkekleqatktiykaeyhkgifkvpp yegkpvqevkeaiakemlekgiaeimyefaeknvisrfgnravikiihdqwfidygnpewkekarkale rmkilpetrraqfeaiidwldkkacarkiglgtplpwdpewvieslsdstiymayytisrhinklrqeg kldpekltpeffdyifleefsedkekelekktgipaeiihemkeefeywypldwrcsgkdlipnhltff ifnhvaifreehwpkgiavngfgtlegqkmskskgnvlnfidaieengadvvrlyimslaehdsdfdwr rkevgklrkqierfyelisqfaeyevkgnvelkdidrwmlhrlnkaikettnaleefrtrtavqwafys imndlrwylrrtegrddeakryvlrtladvwvrlmapftphiceelweklggegfvslakwpepveeww netieaeeefirsvmedikeiievakienakrayiytaedwkwkvaevvsekrdfkssmeelmkdseir khgkevakivqklikertfdvkrineekalreakefmekelgieiiinptedkggkkkqamplkpaifie
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dxz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch