.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dxt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3. To be Published
    Site RSGI
    PDB Id 2dxt Target Id pho001000147.15
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13771, Molecular Weight 26026.15 Da.
    Residues 235 Isoelectric Point 9.15
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2012
    Matthews' coefficent 2.14 Rfactor 0.1875
    Waters 564 Solvent Content 42.40

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2;BTN (BIOTIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 2dxt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch