.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dxe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nucleoside diphosphate kinase in complex with GDP. To be Published
    Site RSGI
    PDB Id 2dxe Target Id pho001000698.7
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13853, Molecular Weight 18313.35 Da.
    Residues 160 Isoelectric Point 5.99
    Sequence mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffkalid yitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvihasdskesaereisl ffkpeelfeypraadwfykkgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.19
    Matthews' coefficent 2.05 Rfactor 0.168
    Waters 380 Solvent Content 40.06

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals CL (CHLORIDE) x 4;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2dxe

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch