The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of trans editing enzyme ProX from E.coli. To be Published
    Site RSGI
    PDB Id 2dxa Target Id eco002000470.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12273, Molecular Weight 17091.99 Da.
    Residues 159 Isoelectric Point 9.02
    Sequence mtpavklleknkisfqihtyehdpaetnfgdevvkklglnpdqvyktllvavngdmkhlavavtpvagq ldlkkvakalgakkvemadpmvaqrstgylvggisplgqkkrlptiidapaqefatiyvsggkrgldie laagdlakildakfadiarrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.215
    Matthews' coefficent 2.07 Rfactor 0.18
    Waters 283 Solvent Content 40.69

    Ligand Information
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 2dxa

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch