The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein, TTHA0132 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dx6 Target Id ttk003001765.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14789, Molecular Weight 16748.41 Da.
    Residues 159 Isoelectric Point 5.94
    Sequence marirvvqgditefqgdaivnaannylklgagvagailrkggpsiqeecdrigkirvgeaavtgagnlp vryvihaavlgdepasletvrkatksalekavelglktvafpllgtgvgglpveavarvmleeikkapd tlevtlygyreedaeairral
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.78 Rfree 0.237
    Matthews' coefficent 1.98 Rfactor 0.195
    Waters 321 Solvent Content 37.83

    Ligand Information
    Ligands ACT (ACETATE) x 2;IPA (ISOPROPYL) x 1


    Google Scholar output for 2dx6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch