.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dx0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the N-terminal SH2 domain of mouse phospholipase C-gamma 2. To be Published
    Site RSGI
    PDB Id 2dx0 Target Id ar_001000485.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS12162, Molecular Weight 14671.73 Da.
    Residues 125 Isoelectric Point 5.96
    Sequence epvqdtpptelhfgekwfhkkvesrtsaekllqeycaetgakdgtflvresetfpndytlsfwrsgrvq hcrirstmengvmkyyltdnltfnsiyaliqhyreahlrcaefelrltdpvpnpnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.262
    Matthews' coefficent 3.49 Rfactor 0.222
    Waters 102 Solvent Content 64.72

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2dx0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch