The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x. J.Biol.Chem. 281 31843-31853 2006
    Site RSGI
    PDB Id 2dwg Target Id mmk001003772.6
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13445, Molecular Weight 19241.68 Da.
    Residues 173 Isoelectric Point 6.17
    Sequence manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflgqnksfwgpl elveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkellsefyevnalmme eegaiiagllvglnvidanfcmkgedldsqvgvid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.22 Rfree 0.292
    Matthews' coefficent 2.50 Rfactor 0.21
    Waters 31 Solvent Content 50.87

    Ligand Information


    Google Scholar output for 2dwg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch